VIP

Name: VIP
Brand: Canada Peptides
Price: 75.0 CAD
Availability: InStock

$75.00

$75.00 ~~$98.00~~

Sold out

This batch of VIP (Vasoactive Intestinal Peptide) has been third party lab tested and verified for quality.

Size: 5mg, 10mg
Contents: Vasoactive Intestinal Peptide
Form: Powder
Purity: 99.44%

TESTED FOR:

PURITY

WEIGHT

STERILITY

ENDOTOXINS(LPS)

Weight - 5mg

5mg 10mg

Product variants

Quantity

Free Reconstitution Solution automatically added to your cart with each order.

This product is Made, Tested & Shipped From Canada.

Ships Today

Order by 1:00 PM EST

Free Shipping

For 2 or more vials

99%+ Purity Guaranteed

COA
Verified+

Trackable Shipping

View full details

Vasoactive Intestinal Peptide (VIP) – 10mg
Vasoactive Intestinal Peptide (VIP) is a naturally occurring neuropeptide composed of 28 amino acids, belonging to the glucagon/secretin peptide family. It is widely distributed in the central and peripheral nervous systems, gastrointestinal tract, lungs, and immune tissues. VIP is of interest in research for its potential effects on vasodilation, smooth muscle relaxation, neurotransmission, and immune modulation.

Overview
VIP functions as a neuromodulator and hormone, acting primarily through VPAC1 and VPAC2 receptors, which are G protein–coupled receptors expressed in numerous tissues. Activation of these receptors is associated with increased cyclic adenosine monophosphate (cAMP) levels, smooth muscle relaxation, and enhanced blood flow.
Research indicates VIP may regulate inflammatory responses, inhibit pro-inflammatory cytokine production, and modulate immune cell signaling. It has been studied in models of pulmonary disease, inflammatory bowel disease, and neurological disorders for its immunoregulatory and tissue-protective properties. VIP’s broad physiological activity also extends to circadian rhythm regulation, endocrine secretion, and gastrointestinal motility.

Chemical Makeup

Molecular Formula: C147H237N43O43S
Molecular Weight: 3326.8 g/mol
Amino Acid Sequence: HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
Other Known Titles: Vasoactive Intestinal Polypeptide, VIP Peptide

Research and Clinical Studies

Vascular and Smooth Muscle Research
VIP is a potent vasodilator in preclinical models, where it promotes increased blood flow and decreased vascular resistance. It has been studied for its potential to protect tissues during ischemic events by improving perfusion.

Immune Modulation
Studies show VIP can downregulate inflammatory cytokines (such as TNF-α, IL-6, and IL-12) and upregulate anti-inflammatory mediators (including IL-10). These findings suggest a role in regulating T helper cell differentiation and immune tolerance.

Pulmonary and Gastrointestinal Models
VIP expression is abundant in lung tissue, where it supports bronchodilation and may reduce pulmonary hypertension in animal studies. In gastrointestinal research, VIP is linked to regulation of intestinal motility, secretory activity, and mucosal immunity.

Neurological and Circadian Functions
VIP has been shown to influence circadian rhythms through activity in the suprachiasmatic nucleus and has demonstrated neuroprotective effects in models of neuroinflammation and neuronal injury.

Endocrine and Metabolic Studies
VIP research highlights its role in stimulating insulin, glucagon, and prolactin release, suggesting a multifaceted impact on endocrine signaling and metabolic regulation.

VIP peptide is available for research and laboratory purposes only. Not for human consumption.

References

Said SI, Mutt V. Polypeptide with broad biological activity: isolation from small intestine. Science. 1970;169(3951):1217–1218. https://pubmed.ncbi.nlm.nih.gov/4318846/
Laburthe M, Couvineau A. Molecular pharmacology and structure of VPAC receptors for VIP and PACAP. Regul Pept. 2002;108(2-3):165–173. https://pubmed.ncbi.nlm.nih.gov/12220735/
Ganea D, Delgado M. The neuropeptides VIP/PACAP and T cells: inhibitors or activators? Curr Pharm Des. 2003;9(12):997–1004. https://pubmed.ncbi.nlm.nih.gov/12678872/
Harmar AJ, et al. Pharmacology and functions of receptors for VIP and PACAP. Br J Pharmacol. 2012;166(1):4–17. https://pubmed.ncbi.nlm.nih.gov/22289055/
Vaudry D, et al. Pituitary adenylate cyclase-activating polypeptide and VIP: neuroprotective peptides. Trends Neurosci. 2009;32(12):728–735. https://pubmed.ncbi.nlm.nih.gov/19896225/
Delgado M, et al. Vasoactive intestinal peptide and the immune system. Endocr Rev. 2004;25(5): 649–685. https://pubmed.ncbi.nlm.nih.gov/15466938/
Said SI. Vasoactive intestinal peptide in the lung. Ann N Y Acad Sci. 1991;629:158–172. https://pubmed.ncbi.nlm.nih.gov/1651451/
Groneberg DA, et al. Role of VIP in airway smooth muscle function. Eur J Pharmacol. 2001;424(1):21–29. https://pubmed.ncbi.nlm.nih.gov/11438328/
Gozes I, et al. Neuroprotective peptide activity of VIP and derivatives. J Mol Neurosci. 2003;20(3):273–285. https://pubmed.ncbi.nlm.nih.gov/12825825/
Martinez C, et al. VIP and immune tolerance in inflammatory bowel disease models. Gut. 1999;45(5): 672–678. https://pubmed.ncbi.nlm.nih.gov/10517907/

Click to view

Page 1

Click to view

Page 1

HIGHEST QUALITY PEPTIDES
Our products are scientifically formulated and manufactured in cGMP-compliant facilities.
FAST DELIVERY
Enjoy fast and reliable 3–5 day shipping.
Dedicated Customer Service
Our customer service team is highly knowledgeable in peptide research and its applications. We’re available 24/7 to assist you.

Verified reviews

Tested. Verified. Trusted.

We take a laboratory-first approach to quality. Each batch is made under controlled conditions and verified by an independent lab (HPLC/MS). We only ship batches that test ≥99% purity, and we provide a full COA, including identity, methods, and chromatograms, for your review.

Shop now

See the Process for Yourself

We make our peptides in our own cGMP lab. Watch the video to see how every vial is produced, tested, and handled with care.

Frequently Asked Questions

Here you'll find answers to common questions.

Contact our support team

Every vial we sell comes from a lab that follows current Good Manufacturing Practices (cGMP). That means each step of production is documented and controlled. Before a batch is released, it’s tested by independent third-party labs for purity, identity, and sterility. Certificates of analysis are available so you can see the exact test results.

Yes. The labs we work with use ISO-certified clean rooms where air quality, equipment, and handling procedures are tightly regulated. Staff are trained to pharmaceutical-grade standards. This ensures the peptides are produced in an environment that minimizes contamination risks.

Peptides in lyophilized (freeze-dried) form are stable at room temperature for transport. Once you receive them, refrigeration is recommended to maintain long-term integrity. We package every order securely to prevent damage and ship promptly, so your vials arrive in optimal condition.

We operate under strict in-house protocols that follow current Good Manufacturing Practices (cGMP). That means our team oversees the entire process from sourcing raw amino acids to the final lyophilized vial. Nothing is outsourced or repackaged. This gives us full control over purity, consistency, and sterility, and it’s why we can stand behind every single vial we ship.

Store them in the refrigerator, away from direct light and heat. If you need to keep them longer, some peptides can be stored frozen. Each vial comes with clear handling instructions so you know the proper conditions for stability.

The strongest proof is transparency. For every peptide, we can provide certificates of analysis, manufacturing documentation, and references to the published scientific research behind it. If you ever have questions, we’ll show you the data rather than ask you to take our word for it.

The difference is transparency. Most sites give you a product name and a price. We provide full batch testing, lab documentation, and direct access to certificates of analysis so you don’t have to guess what you’re getting. When you order from us, you know exactly what’s in the vial, where it was made, and how it was verified.

VIP

VIP

Ships Today

Free Shipping

HIGHEST QUALITY PEPTIDES

FAST DELIVERY

Dedicated Customer Service

Tested. Verified. Trusted.

You may also like

Frequently Asked Questions